PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG223200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 382aa    MW: 40319.9 Da    PI: 5.9256
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG223200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.8e-11181239563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+     l+se+
  Pavir.7KG223200.1.p 181 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQSEATTLSAQLAMLQRDTTGLTSEN 239
                          9***********************************************99999888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.9E-18177241IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.162179242IPR004827Basic-leucine zipper domain
PfamPF001706.6E-9181239IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.85E-11181236No hitNo description
Gene3DG3DSA:1.20.5.1704.3E-11181236No hitNo description
CDDcd147037.04E-25182231No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDPAPPVDPA ASCSVSTSAS ASASAAAPGD MAAMLPDSPP RRGAGHRRAQ SEILLGGAAL  60
PDDLTFDADL GVVGEACGAG DEDEEDEDED EDGGGGAGGS RMFEMFLQNG GTLPGPPEPS  120
AHPHPAATPP PRPRHQHSMS MDGSTSLLGS TAAGTPGRAG ADAKKAISDA KLAELALVDP  180
KRAKRILANR QSAARSKERK MRYIAELERK VQTLQSEATT LSAQLAMLQR DTTGLTSENS  240
DLKIRVQTME QQVRLQDALN DRLRDEIQQL KIATGQVNAS IGKMGNFGVS SFGGNPQSYQ  300
RSHIQSLLAA QQLLQLQIHS QHQQQQQPHL QQQQHLSTAQ QHLLLQESLP FPGDLKMKGL  360
AMPSHGQNAG ASDSRAVQSE P*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.42020.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976085.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ040885e-90POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU90.0C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-65bZIP family protein